anti-Human FZD10 antibody for Immunocytochemistry

Recommended FZD10 Antibody (supplied by: Log in to see )

Frizzled Family Receptor 10 (FZD10) Antibodies
  • fz3
  • fz10
  • zg03
  • zg10
  • Fz-10
  • Xfr9
  • Xfz10
  • frizzled-10
  • frizzled10
  • fze7
  • hfz10
  • CD350
  • FZ-10
  • Fz10
  • FzE7
  • hFz10
  • cFz-10
  • fk48e04
  • fz4
  • fzb
  • wu:fk48e04
  • zg04
  • frizzled homolog 1
  • frizzled family receptor 10
  • frizzled homolog 10
  • frizzled homolog 10 (Drosophila)
  • fzd1
  • fzd10
  • FZD10
  • Fzd10
This FZD10 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4312583
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4312584 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal


Antigen Frizzled Family Receptor 10 (FZD10) Antibodies
Reactivity Human
(55), (48), (25), (6), (4), (4), (4), (3), (2), (2), (1)
Host Rabbit
Conjugate This FZD10 antibody is un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(36), (20), (14), (13), (8), (7), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-FZD10 Antibody

Target Details FZD10 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV
Isotype IgG

Target Details FZD10

Product Details anti-FZD10 Antibody Application Details Handling Images back to top
Alternative Name Frizzled-10 (FZD10 Antibody Abstract)
Background Gene Symbol: FZD10
Gene ID 11211
Pathways WNT Signaling

Application Details

Product Details anti-FZD10 Antibody Target Details FZD10 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-FZD10 Antibody Target Details FZD10 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-FZD10 Antibody Target Details FZD10 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Frizzled Family Receptor 10 (FZD10) antibody (ABIN4312583) Immunocytochemistry/Immunofluorescence: Frizzled-10 Antibody [NBP1-85753] - Immunoflu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Frizzled Family Receptor 10 (FZD10) antibody (ABIN4312583) Immunohistochemistry-Paraffin: Frizzled-10 Antibody [NBP1-85753] - Immunohistochemica...