anti-Human SFRP1 antibody for Immunofluorescence

Recommended SFRP1 Antibody (supplied by: Log in to see )

Secreted Frizzled-Related Protein 1 (SFRP1) Antibodies
  • SFRP1
  • XfrzA
  • frp
  • frp-1
  • frp1
  • frzA
  • sarp2
  • sfrp1
  • LOC100231868
  • FRP
  • FRP-1
  • FRP1
  • FrzA
  • SARP2
  • CSFRP1
  • 2210415K03Rik
  • AW011917
  • AW107218
  • AW742929
  • sFRP-1
  • secreted frizzled-related protein 1
  • Secreted frizzled-related protein 1
  • secreted frizzled-related protein 1-like
  • SFRP1
  • sfrp1
  • LOC100231868
  • Sfrp1
  • LOC100621622
This SFRP1 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5079597
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5551728 EIA IF IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN303265 EIA IF IHC (p) WB Rabbit AA 43-54 Log in to see Polyclonal
1 ABIN214495 IF IHC (p) ELISA WB Rabbit AA 43-54 Log in to see Polyclonal
1 ABIN2470303 IF IHC ELISA WB Rabbit AA 43-54 Log in to see Polyclonal
1 ABIN153385 ICC IF IHC (p) IHC ELISA WB Rabbit Log in to see Polyclonal
1 ABIN1739218 IF IHC (p) ELISA WB Rabbit IgG AA 43-54 Log in to see Polyclonal
1 ABIN4905143 IF IP WB Mouse IgG Log in to see
1 ABIN4353133 ELISA ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2359198 IF IHC ELISA WB Rabbit AA 43-54 Log in to see Polyclonal
1 ABIN2359211 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal


Antigen Secreted Frizzled-Related Protein 1 (SFRP1) Antibodies
Reactivity Human
(96), (43), (37), (11), (5), (4), (3), (2), (1), (1)
Host Rabbit
(82), (25), (2), (1)
Conjugate This SFRP1 antibody is un-conjugated
(9), (6), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(68), (64), (34), (27), (14), (10), (5), (5), (5), (4), (3), (2)
Supplier Log in to see

Product Details anti-SFRP1 Antibody

Target Details SFRP1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDL
Isotype IgG

Target Details SFRP1

Product Details anti-SFRP1 Antibody Application Details Handling Images back to top
Alternative Name sFRP-1 (SFRP1 Antibody Abstract)
Background Gene Symbol: SFRP1
Gene ID 6422
Pathways WNT Signaling, Intracellular Steroid Hormone Receptor Signaling Pathway, Negative Regulation of Hormone Secretion, Regulation of Intracellular Steroid Hormone Receptor Signaling, Stem Cell Maintenance, Tube Formation, Positive Regulation of fat Cell Differentiation

Application Details

Product Details anti-SFRP1 Antibody Target Details SFRP1 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-SFRP1 Antibody Target Details SFRP1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-SFRP1 Antibody Target Details SFRP1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Secreted Frizzled-Related Protein 1 (SFRP1) antibody (ABIN5079597) Western Blot: sFRP-1 Antibody - Western blot analysis in human cell line RT-4.
Immunofluorescence (IF) image for anti-Secreted Frizzled-Related Protein 1 (SFRP1) antibody (ABIN5079597) Immunocytochemistry/Immunofluorescence: sFRP-1 Antibody - Staining of human cell lin...