anti-Human WNT9B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended WNT9B Antibody (supplied by: Log in to see )

Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) Antibodies
  • WNT9B
  • wnt-9b
  • Wnt14b
  • Wnt15
  • clf
  • clf1
  • wnt-14b
  • wnt-15
  • WNT14B
  • WNT15
  • wnt9b protein
  • golgi SNAP receptor complex member 2
  • wingless-type MMTV integration site family, member 9B
  • wingless-type MMTV integration site 9B
  • wnt9b
  • GOSR2
  • WNT9B
  • Wnt9b
This WNT9B antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4366213
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN202335 IHC (p) WB Rabbit IgG AA 231-280 Log in to see Polyclonal
1 ABIN1049489 IHC (p) Rabbit Internal Region Log in to see Polyclonal
1 ABIN1049490 IHC (p) Rabbit Internal Region Log in to see Polyclonal
1 ABIN1740846 IHC (p) Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1740845 IHC (p) Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN4366210 IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal
1 ABIN4366211 IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal
1 ABIN4366208 IHC (p) Rabbit Log in to see Polyclonal
1 ABIN5590982 IHC (p) Rabbit Log in to see Polyclonal
1 ABIN4366212 IHC IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN2764587 IHC (p) Rabbit Internal Region Log in to see Polyclonal
1 ABIN2764588 IHC (p) Rabbit Internal Region Log in to see Polyclonal

Similar anti-WNT9B Antibodies

Application / Reactivity Human
ELISA 18 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Immunohistochemistry (IHC) 9 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies
Western Blotting (WB) 29 Antibodies


Antigen Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) Antibodies
Reactivity Human
(42), (9), (5), (3), (3), (3), (2), (2), (2), (2), (1)
Host Rabbit
(25), (16), (2)
Conjugate This WNT9B antibody is un-conjugated
(1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(30), (19), (12), (8), (1)
Supplier Log in to see

Product Details anti-WNT9B Antibody

Target Details WNT9B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: CWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSP
Isotype IgG

Target Details WNT9B

Product Details anti-WNT9B Antibody Application Details Handling Images back to top
Alternative Name Wnt-9b (WNT9B Antibody Abstract)
Background Gene Symbol: WNT9B
Gene ID 7484
UniProt O14905
Pathways WNT Signaling, Tube Formation

Application Details

Product Details anti-WNT9B Antibody Target Details WNT9B Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-WNT9B Antibody Target Details WNT9B Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-WNT9B Antibody Target Details WNT9B Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WNT9B antibody (Wingless-Type MMTV Integration Site Family, Member 9B) (ABIN4366213) Immunohistochemistry-Paraffin: Wnt-9b Antibody - Staining of liver cancer.
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WNT9B antibody (Wingless-Type MMTV Integration Site Family, Member 9B) (ABIN4366213) Immunohistochemistry-Paraffin: Wnt-9b Antibody - Staining of human kidney shows stro...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WNT9B antibody (Wingless-Type MMTV Integration Site Family, Member 9B) (ABIN4366213) Immunohistochemistry-Paraffin: Wnt-9b Antibody - Staining of skin.