TSHB antibody (AA 20-134)

Catalog No. ABIN1078576

Product Details anti-TSHB Antibody

Target: TSHB (Thyroid Stimulating Hormone, beta (TSHB))

Binding Specificity: AA 20-134

Reactivity: Chicken

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSHB antibody is un-conjugated

Application: ELISA, Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-S VCAPSEYTIH VEKRECAYCL AINTTICAGF CMTRDSNGKK LLLKSALSQN VCTYKEMFYQ TALIPGCPHH TIPYYSYPVA ISCKCGKCNT DYSDCVHEKV RTNYCTKPQK LCNM

Specificity: It has been selected for its ability to recognize TSHb in immunohistochemical staining and Western blotting.

Purification: Affinity Chromatography

Immunogen: Recombinant TSHb expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against TSHb.

Isotype: IgG

Application Details

Application Notes: Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user.

Comment:

Content: The quality control contains recombinant TSHb (Ser20~Met134) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % .

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.

Preservative: Sodium azide

Precaution of Use: WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.

Handling Advice: Avoid repeated freeze/thaw cycles

Storage: 4 °C

Storage Comment: Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.

Expiry Date: 12 months

Target Details for TSHB

Target: TSHB (Thyroid Stimulating Hormone, beta (TSHB))

Alternative Name: Thyroid Stimulating Hormone Beta (TSHb) (TSHB Products)

Synonyms: TSH-B antibody, TSH-BETA antibody, TSHB antibody, thyroid stimulating hormone beta antibody, thyroid stimulating hormone, beta antibody, thyroid stimulating hormone, beta subunit antibody, TSHB antibody, Tshb antibody, tshb antibody

Pathways: Thyroid Hormone Synthesis, Peptide Hormone Metabolism