Parathyroid Hormone 2 (PTH2) antibody
-
- Target See all Parathyroid Hormone 2 (PTH2) Antibodies
- Parathyroid Hormone 2 (PTH2)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
- Application
- ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA)
- Specificity
- Human, bovine, canis TIP 39
- Immunogen
- synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)
-
-
- Application Notes
- ELISA (1/4.000) RIA (1/ 2.000), Immunohistochemistry (paraffin section, 1:100) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Resuspend in aqua bidest.
- Storage
- 4 °C
-
- Target
- Parathyroid Hormone 2 (PTH2)
- Alternative Name
- TIP 39 (PTH2 Products)
- Background
- Serum
- Pathways
- Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development
-