Parathyroid Hormone 2 (PTH2) antibody

Catalog No. ABIN109738

This anti- antibody is a Rabbit Polyclonal antibody detecting in ELISA, IHC (p) and RIA. Suitable for Human.

Quick Overview for Parathyroid Hormone 2 (PTH2) antibody (ABIN109738)

Target: Parathyroid Hormone 2 (PTH2)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA)

Product Details

Specificity: Human, bovine, canis TIP 39

Immunogen: synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)

Application Details

Application Notes: ELISA (1/4.000) RIA (1/ 2.000), Immunohistochemistry (paraffin section, 1:100) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details

Target: Parathyroid Hormone 2 (PTH2)

Alternative Name: TIP 39

Background: Serum

Pathways: Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development