PTH antibody (AA 1-34)

Catalog No. ABIN109749

The Rat Monoclonal anti-PTH antibody (Clone 3B3) (ABIN109749) specifically detects PTH in IHC and ELISA. The antibody is reactive with Human samples.

Quick Overview for PTH antibody (AA 1-34) (ABIN109749)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Human

Host: Rat

Clonality: Monoclonal

Conjugate: This PTH antibody is un-conjugated

Application: Immunohistochemistry (IHC), ELISA

Clone: 3B3

Product Details anti-PTH Antibody

Binding Specificity: AA 1-34

Specificity: Human oxidized PTH (aa 1-34), native PTH in tissue sections and in circulation

Purification: Purified

Immunogen: Synthetic human PTH (aa 1-34) BSA conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnf)

Isotype: IgG2b

Application Details

Application Notes: ELISA, Immunohistochemistry (cryo-sections and paraffin-sections 1/25-50)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone

Target Type: Hormone

Background: Cell supernatant, Prot. A purified 0,01 M sodiumphosphate, 0,15 M sodium chloride pH 7,2

Gene ID: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process