beta Defensin 1 antibody (AA 1-36)

Catalog No. ABIN109994

This Mouse Monoclonal antibody specifically detects beta Defensin 1 in WB and ELISA. It exhibits reactivity toward Human.

Quick Overview for beta Defensin 1 antibody (AA 1-36) (ABIN109994)

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This beta Defensin 1 antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Clone: M4-14b-H4

Product Details anti-beta Defensin 1 Antibody

Binding Specificity: AA 1-36

Specificity: Synthetic human 61538-Defensin 1 (aa- 1-36)

Immunogen: Synthetic human 61538-Defensin 1 (aa 1-36) (3 disulfide bridges)(dhyncvssggqclysacpiftkiqgtcyrgkakcck)

Isotype: IgG1

Application Details

Application Notes: ELISA, Western blot This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for beta Defensin 1

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Alternative Name: Beta-Defensin 1

Background: Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4