ACBD4 antibody (N-Term)
-
- Target See all ACBD4 Antibodies
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Cow, Dog, Zebrafish (Danio rerio), Xenopus laevis, Chicken
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACBD4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Sequence
- MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT
- Cross-Reactivity (Details)
- Species reactivity (expected):Mouse, Rat, Bovine, Dog, African clawed frog, Zebrafish, ChickenSpecies reactivity (tested):Human
- Purification
- Purified using peptide immunoaffinity column
- Immunogen
- Synthetic peptide directed towards the N terminal of human ACBD4
- Top Product
- Discover our top product ACBD4 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 50 μL of distilled water to a final concentration of 1 mg/mL.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Target
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
- Alternative Name
- ACBD4 (ACBD4 Products)
- Background
- ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.Synonyms: Acyl-CoA-binding domain-containing protein 4, HMFT0700
- Gene ID
- 79777
- NCBI Accession
- NP_078998
-