Acyl-CoA Binding Domain Containing 4 (ACBD4) (N-Term) antibody

Details for Product No. ABIN635315
Antigen
Epitope
N-Term
8
7
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
47
28
27
8
7
4
4
4
3
3
2
2
2
1
Host
Rabbit
44
3
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
27
14
13
6
3
1
Options
Immunogen ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
Specificity ACBD4 antibody was raised against the N terminal of ACBD4
Purification Affinity purified
Antigen
Alternative Name ACBD4 (ACBD4 Antibody Abstract)
Background ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.
Molecular Weight 35 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ACBD4 Blocking Peptide, catalog no. 33R-6881, is also available for use as a blocking control in assays to test for specificity of this ACBD4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Acyl-CoA Binding Domain Containing 4 (ACBD4) (N-Term) antibody (ABIN635315) ACBD4 antibody used at 1 ug/ml to detect target protein.