This antibody Clone 158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated Integrin subunit α3A. A broad species reactivity is expected because of the conserved nature of the epitope.
Purification
Purified
Immunogen
158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
ITGA3
Reactivity: Human
WB
Host: Rabbit
Polyclonal
RB52792
unconjugated
Application Notes
158A3 is suitable for Immunoblotting, Immunocytochemistry, Immunohistochemistry onfrozen sections. Recommended dilutions: 1/100-1/200 for Immunohistochemistry with avidin-biotinylatedhorseradish peroxidase complex (ABC) as detection reagent, and 1/100-1/1000 forImmunoblotting applications. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Restrictions
For Research Use only
Concentration
1.0 mg/mL
Buffer
PBS, 0.09 % Sodium Azide
Preservative
Sodium azide
Precaution of Use
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice
Avoid repeated freezing and thawing.
Storage
4 °C/-20 °C
Storage Comment
Store lyophilized (preferably in a desiccator) at 2-8 °C and reconstituted (in aliquots) at -20 °C.
Target
ITGA3
(Integrin, alpha 3 (ITGA3))
Alternative Name
CD49c / ITGA3
Background
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated a and b subunits. More than 18 a and 8 b subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits a3 and a6, two cytoplasmic variants, A and B, have been identified.Synonyms: CD49 antigen-like family member C, FRP-2, GAPB3, Galactoprotein B3, ITGA-3, ITGAG3, Integrin alpha-3, MSK18, VLA-3 alpha chain, VLA3