Caspase 3 antibody (AA 183-277) (Biotin)

Catalog No. ABIN1173315

This anti-Caspase 3 antibody is a Rabbit Polyclonal antibody detecting Caspase 3 in WB, IHC and ICC. Suitable for Human.

Quick Overview for Caspase 3 antibody (AA 183-277) (Biotin) (ABIN1173315)

Target: Caspase 3 (CASP3)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Caspase 3 antibody is conjugated to Biotin

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Product Details anti-Caspase 3 Antibody (Biotin)

Binding Specificity: AA 183-277

Purpose: Biotin-Linked Polyclonal Antibody to Caspase 3 (CASP3)

Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF- ACHKIPVE ADFLYAYSTA PGYYSWRNSK DGSWFIQSLC AMLKQYADKL EFMHILTRVN RKVATEFESF SFDATFHAKK QIPCIVSMLT KELYFYH

Specificity: The antibody is a rabbit polyclonal antibody raised against CASP3. It has been selected for its ability to recognize CASP3 in immunohistochemical staining and western blotting.

Cross-Reactivity: Mouse, Rat

Purification: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogen: Recombinant CASP3 expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against CASP3 conjugated to biotin.

Isotype: IgG

Application Details

Application Notes: Western blotting: 0.2-2 μg/mL,1:250-2500 Immunohistochemistry: 5-20 μg/mL,1:25-100 Immunocytochemistry: 5-20 μg/mL,1:25-100 Optimal working dilutions must be determined by end user.

Comment:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 500 μg/mL

Buffer: PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.

Preservative: Sodium azide

Precaution of Use: WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.

Handling Advice: Avoid repeated freeze/thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Expiry Date: 12 months

Target Details for Caspase 3

Target: Caspase 3 (CASP3)

Alternative Name: Caspase 3

Background: CPP32, CPP32B, SCA1, Apoptain, Yama, Apoptosis-Related Cysteine Peptidase, Cysteinyl Aspartate Specific Proteinases 3, SREBP cleavage activity 1

Pathways: Apoptosis, Caspase Cascade in Apoptosis, Sensory Perception of Sound, ER-Nucleus Signaling, Positive Regulation of Endopeptidase Activity, Activated T Cell Proliferation