Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Neuronal Guanine Nucleotide Exchange Factor (NGEF) (AA 612-710) antibody Primary Antibody

NGEF Reactivity: Human ELISA, WB Host: Mouse Monoclonal 6E7 unconjugated
Catalog No. ABIN1327160
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Neuronal Guanine Nucleotide Exchange Factor (NGEF)
    Binding Specificity
    AA 612-710
    • 15
    • 3
    • 2
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 37
    • 35
    • 34
    Host
    Mouse
    • 38
    Clonality
    Monoclonal
    • 38
    Conjugate
    Un-conjugated
    • 8
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Application
    ELISA, Western Blotting (WB)
    • 26
    • 14
    • 6
    • 4
    • 1
    • 1
    • 1
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant NGEF.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: NGEF (NP_062824.1, 612 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: LDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ

    Clone
    6E7
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Neuronal Guanine Nucleotide Exchange Factor (NGEF)
    Alternative Name
    NGEF (NGEF Antibody Abstract)
    Synonyms
    Ephexin-1, ARHGEF27, EPHEXIN, Tims2, ephexin, Besh3, ephexin-1, neuronal guanine nucleotide exchange factor, NGEF, Ngef
    Background
    Full Gene Name: neuronal guanine nucleotide exchange factor
    Synonyms: EPHEXIN
    Gene ID
    25791
    NCBI Accession
    NP_062824, NM_019850
    Pathways
    Neurotrophin Signaling Pathway
You are here:
help Support