Complement Component 1, Q Subcomponent-Like 3 (C1QL3) (AA 1-255) antibody Primary Antibody
C1QL3
Reactivity: Human
WB
Host: Mouse
Polyclonal
camera_alt 1
Catalog No. ABIN1327439
$440.00
Plus shipping costs $45.00
50 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-255
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a full-length human C1QL3 protein.
- Cross-Reactivity
- Human
- Immunogen
immunogen: C1QL3 (AAI60038.1, 1 a.a. ~ 255 a.a) full-length human protein.
Immunogen Sequence: MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- C1QL3 (C1QL3 Antibody Abstract)
- Background
- Full Gene Name: complement component 1, q subcomponent-like 3
Synonyms: C1ql,K100 - Gene ID
- 389941
You are here: