ZNF93 antibody

Catalog No. ABIN1449891

The Rabbit Polyclonal anti-ZNF93 antibody (ABIN1449891) specifically detects ZNF93 in WB. The antibody is reactive with Human, Cow, Mouse, Rat, Zebrafish (Danio rerio) and Xenopus laevis samples.

Quick Overview for ZNF93 antibody (ABIN1449891)

Target: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Reactivity: Human, Cow, Mouse, Rat, Zebrafish (Danio rerio), Xenopus laevis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZNF93 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZNF93 Antibody

Cross-Reactivity (Details): Species reactivity (tested):Human, Mouse, Rat, Zebrafish, African clawed frog, Bovine

Purification: Purified using peptide immunoaffinity column

Immunogen: A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Reconstitution: Add 50 μL of distilled water to a final concentration of 1 mg/mL.

Concentration: 1.0 mg/mL after reconstitution

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Target Details for ZNF93

Target: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Alternative Name: ZNF93

Background: ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.Synonyms: HTF34, ZNF505, Zinc finger protein 505, Zinc finger protein 93, Zinc finger protein HTF34

Molecular Weight: 71 kDa (620 aa)

Gene ID: 81931

NCBI Accession: NP_112495