SRA1 antibody (AA 519-556)

Catalog No. ABIN1742561

The Mouse Monoclonal anti-SRA1 antibody has been validated for WB, ELISA and IP. It is suitable to detect SRA1 in samples from Human, Rat and Mouse. There are 2+ publications available.

Quick Overview for SRA1 antibody (AA 519-556) (ABIN1742561)

Target: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Reactivity: Human, Rat, Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This SRA1 antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Immunoprecipitation (IP)

Clone: 30A4

Product Details anti-SRA1 Antibody

Binding Specificity: AA 519-556

Specificity: Specific for Sra 1

Cross-Reactivity (Details): may cross-react with CYFIP 2/PIR 121 due to high sequence homology.

Immunogen: Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.

Isotype: IgG1

Application Details

Application Notes: WB: 1:100 up to 1:2000, ICC: not recommended IHC: not recommended

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: For reconstitution add 100µl H2O to get a 1mg/ml solution in PBS.

Buffer: PBS. Azide was added before lyophilization.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Do not freeze! Antibodies should be stored at +4°C when still lyophilized.

Storage: -20 °C

Storage Comment: Reconstitute and aliquot and store at -20°C to -80°C until use. Antibodies should be stored at +4°C when still lyophilized.

References for anti-SRA1 antibody (ABIN1742561)

Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." in: PLoS ONE, Vol. 7, Issue 8, pp. e42422, (2012) (PubMed).

Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." in: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, (2006) (PubMed).

Target Details for SRA1

Target: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Alternative Name: Sra 1

Background: Synonyms: CYFIP 1

Pathways: EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development