The Mouse Monoclonal anti-SRA1 antibody has been validated for WB, ELISA and IP. It is suitable to detect SRA1 in samples from Human, Rat and Mouse. There are 2+ publications available.
may cross-react with CYFIP 2/PIR 121 due to high sequence homology.
Purification
purified IgG. Azide was added before lyophilization.
Immunogen
Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.
SRA1
Reactivity: Human
WB, IP
Host: Rabbit
Polyclonal
unconjugated
Application Notes
WB: 1 : 100 up to 1 : 2000 (AP staining)
Restrictions
For Research Use only
Format
Lyophilized
Reconstitution
For reconstitution add 100 µL H2O to get a 1mg/ml solution of antibody in PBS. Then aliquot and store at -20 °C until use.
Buffer
PBS, 0.02% sodium azide
Preservative
Sodium azide
Precaution of Use
This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice
Do not store diluted antibody solutions unless you add detergent or carrier proteins such as goat serum, BSA or others. IgG sticks to glass and plastic. Any IgG solution below 0.1 mg/mL protein will quickly adsorb and denature and thus loose activity! Repetitive freeze-thawing of dilute purified IgG is almost certain to lead to substantial losses.
Storage
-20 °C
Storage Comment
Unlabeled antibodies are stable in this form without loss of quality at ambient temperatures for several weeks or even months. They can be stored at 4 °C for several years.
Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." in: PLoS ONE, Vol. 7, Issue 8, pp. e42422, (2012) (PubMed).
Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." in: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, (2006) (PubMed).