TLR4 antibody (AA 161-192)

Catalog No. ABIN1819425

This anti-TLR4 antibody is a Goat Polyclonal antibody detecting TLR4 in WB, IHC and IHC (p). Suitable for Human and Mouse.

Quick Overview for TLR4 antibody (AA 161-192) (ABIN1819425)

Target: TLR4 (Toll-Like Receptor 4 (TLR4))

Reactivity: Human, Mouse

Host: Goat

Clonality: Polyclonal

Conjugate: This TLR4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-TLR4 Antibody

Binding Specificity: AA 161-192

Specificity: Recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kD single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity. Recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. Is reported to be suitable for use in immunocytochemistry on acetone fixed cells.

Purification: Affinity purified

Immunogen: Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%), Gorilla, Baboon, Monkey (97%), Hamster (87%), Sheep, Goat, Dolphin, Zebu, Bovine, Guinea pig (84%), Panda, Cat, Pig (81%).

Type of Immunogen: Synthetic peptide

Isotype: IgG

Application Details

Application Notes: Approved: IHC, IHC-P (1:100 - 1:300), WB (1:1000)

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 0.1 % sodium azide, 0.1 % BSA

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C,-20 °C

Storage Comment: 4°C or -20°C, Avoid freeze-thaw cycles.

Target Details for TLR4

Target: TLR4 (Toll-Like Receptor 4 (TLR4))

Alternative Name: TLR4

Background: Name/Gene ID: TLR4
Family: Toll-like Receptor

Synonyms: TLR4, CD284, CD284 antigen, Homolog of Drosophila toll, TLR-4, TOLL, ARMD10, Toll-like receptor 4, HToll

Gene ID: 7099

UniProt: O00206

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades, Inflammasome, S100 Proteins