Annexin a1 antibody (AA 214-341) (APC)

Catalog No. ABIN1858016

The Guinea Pig Polyclonal anti-Annexin a1 antibody has been validated for WB, IHC, IP and ICC. It is suitable to detect Annexin a1 in samples from Rabbit.

Quick Overview for Annexin a1 antibody (AA 214-341) (APC) (ABIN1858016)

Target: Annexin a1 (ANXA1) (Annexin A1 (ANXA1))

Reactivity: Rabbit

Host: Guinea Pig

Clonality: Polyclonal

Conjugate: This Annexin a1 antibody is conjugated to APC

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Product Details anti-Annexin a1 Antibody (APC)

Binding Specificity: AA 214-341

Purpose: Polyclonal Antibody to Annexin A1 (ANXA1)

Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-KGADVNV FTTILTTRSY LHLRRVFQKY SKYSQHDMNK VLDLELKGDI EKCLTAIVQC ATCKPAYFAE KLYQAMKGAG TRHKALIRIM VSRSEVDMND IKAFYQKKYG VSLCQAILDE TKGDYEKILV A

Specificity: The antibody is a cavia polyclonal antibody raised against ANXA1. It has been selected for its ability to recognize ANXA1 in immunohistochemical staining and western blotting.

Cross-Reactivity: Human, Mouse, Rat

Purification: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogen: RPE787Rb02Recombinant Annexin A1 (ANXA1)

Isotype: IgG

Application Details

Application Notes: Western blotting: 0.5-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.

Comment:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.

Preservative: ProClin

Precaution of Use: WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.

Handling Advice: Avoid repeated freeze/thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Expiry Date: 12 months

Target Details for Annexin a1

Target: Annexin a1 (ANXA1) (Annexin A1 (ANXA1))

Alternative Name: ANXA1

Background: ANX-A1, ANX1, LPC1, Lipocortin I, Chromobindin-9, Calpactin II, Phospholipase A2 inhibitory protein

Pathways: Hormone Transport