The Goat Polyclonal anti-TLR5 antibody (ABIN187770) specifically detects TLR5 in WB, FACS, IHC (p) and IF.
The antibody is reactive with Human samples.
Recognizes human Toll-like receptor 5 (TLR5). Peptide sequence is >50% identical to other human TLRs in this region. Species Reactivity: Human. Other species not tested.
Immunogen
Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5.
Flow Cytometry Immunocytochemistry: 1:500 Immunohistochemistry: Paraffin sections 1:250 Western blot The optimal dilution for a specific application should be determined by the researcher.
Restrictions
For Research Use only
Format
Liquid
Buffer
Liquid. 100 µg of peptide affinity purified antibody in PBS at 2 mg/ml, containing 1 mg/ml BSA and 0.1% sodium azide.
Preservative
Sodium azide
Precaution of Use
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.