IL21 Receptor antibody (AA 35-64)

Catalog No. ABIN342772

Product Details anti-IL21 Receptor Antibody

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Binding Specificity: AA 35-64

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL21 Receptor antibody is un-conjugated

Application: ELISA, Immunohistochemistry (IHC), Flow Cytometry (FACS)

Specificity: Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes mouse IL-21 receptor. Not tested for cross-reactivity to human IL-21 receptor.

Predicted Reactivity: Percent identity by BLAST analysis: Mouse (100%) Rat (90%).

Purification: Immunoaffinity purified

Immunogen: Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%), Rat (90%).

Type of Immunogen: Synthetic peptide

Application Details

Application Notes: Approved: ELISA (1:100000), Flo, IHC

Comment:

Target Species of Antibody: Mouse

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Aliquot to Avoid freeze/thaw cycles.

Storage: -20 °C

Storage Comment: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Target Details for IL21 Receptor

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Alternative Name: IL21R / IL-21R (IL21R Products)

Background: Name/Gene ID: IL21R
Family: Interleukin

Synonyms: IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor

Gene ID: 50615

UniProt: Q9HBE5

Pathways: JAK-STAT Signaling