ITGA3 antibody (Cytoplasmic Domain)

Catalog No. ABIN201109

This Mouse Monoclonal antibody specifically detects ITGA3 in WB, IHC, ICC and IHC (fro). It exhibits reactivity toward Human.

Quick Overview for ITGA3 antibody (Cytoplasmic Domain) (ABIN201109)

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This ITGA3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: 29A3

Product Details anti-ITGA3 Antibody

Binding Specificity: Cytoplasmic Domain

Specificity: Recognizes specifically the cytoplasmic domain of human integrin subunit a3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.

Purification: Protein G purified

Immunogen: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Type of Immunogen: Synthetic peptide - KLH conjugated

Isotype: IgG1

Application Details

Application Notes: Approved: ICC, IHC, IHC-Fr, WB

Usage: Immunohistochemistry (frozen): 1:100 - 1:200 using avidn-biotinylated HRP complex (ABC) as detection reagent. Western Blot: 1:100 - 1:1000. Optimum dilutions to be determined by researcher.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS,  pH 7.2, 0.1 % sodium azide. No stabilizing proteins added.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeat freeze-thaw cycles.

Storage: 4 °C,-20 °C

Storage Comment: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Target Details for ITGA3

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Alternative Name: ITGA3 / CD49c

Background: Name/Gene ID: ITGA3
Family: Integrin

Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18

Gene ID: 3675

UniProt: P26006

Pathways: CXCR4-mediated Signaling Events, Integrin Complex