ANO1 antibody

Catalog No. ABIN2255013

The Mouse Monoclonal anti-ANO1 antibody (Clone DG1-447-DOG-1-1 (mixture of 2 clones)) (ABIN2255013) specifically detects ANO1 in IHC, IF, FACS, WB and IP. The antibody is reactive with Human samples.

Quick Overview for ANO1 antibody (ABIN2255013)

Target: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This ANO1 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Immunofluorescence (IF), Flow Cytometry (FACS), Western Blotting (WB), Immunoprecipitation (IP)

Clone: DG1-447-DOG-1-1 (mixture of 2 clones)

Product Details anti-ANO1 Antibody

Sequence: MSDFVDWVIP DIPKDISQQI HKEKVLMVEL FMREEQDKQQ LLETCMEKER QKDEPPCNHH NTKACPDSLG SPAPSHAYHG GVL

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: DOG-1 (ANO1, Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A)

Purification: Purified by Protein A/G affinity chromatography.

Immunogen: Recombinant human DOG-1 protein (clone DG1/447), A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (clone DOG-1.1). Cellular Localization: Cell Surface and Cytoplasmic

Isotype: IgG1 kappa

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Supplied as a liquid in PBS, 0.05 % BSA, 0.05 % sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for ANO1

Target: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Alternative Name: DOG-1

Background: Cellular Localization: Cell Surface and Cytoplasmic