IL21 Receptor antibody (N-Term)

Catalog No. ABIN7581146

This Goat Polyclonal antibody specifically detects IL21 Receptor in ELISA and IHC. It exhibits reactivity toward Human.

Quick Overview for IL21 Receptor antibody (N-Term) (ABIN7581146)

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This IL21 Receptor antibody is un-conjugated

Application: ELISA, Immunohistochemistry (IHC)

Product Details anti-IL21 Receptor Antibody

Binding Specificity: N-Term

Sequence: CILEMWNLHP STLTLTWQDQ YEELKDEATS

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: Interleukin 21 Receptor (IL-21)

Purification: Purified by immunoaffinity chromatography.

Immunogen: Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor.

Isotype: IgG

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Supplied as a liquid in PBS, 0.09 % sodium azide before the addition of 40 % glycerol. No preservative added.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for IL21 Receptor

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Alternative Name: Interleukin 21 Receptor

Pathways: JAK-STAT Signaling