PTH antibody (AA 1-38)

Catalog No. ABIN2330223

The Mouse Monoclonal anti-PTH antibody (Clone B1-70) (ABIN2330223) specifically detects PTH in ELISA, RIA and IC. The antibody is reactive with Human samples.

Quick Overview for PTH antibody (AA 1-38) (ABIN2330223)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This PTH antibody is un-conjugated

Application: ELISA, Radioimmunoassay (RIA), Immunochromatography (IC)

Clone: B1-70

Product Details anti-PTH Antibody

Binding Specificity: AA 1-38

Sequence: SVSEIQLMHN LGKHLNSMER VEWLRKKLQD VHNFVALG

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: Parathyroid Hormone, aa1-38 (PTH, Parathormone, Parathyrin)

Purification: Purified by immunoaffinity chromatography.

Immunogen: Synthetic human PTH (aa 1-38) polylysine conjugated (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG)

Isotype: IgG1

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Reconstitute in ddH2O.

Buffer: Supplied as a lyophilized powder in 50 mM Tris, pH 7.2.

Storage: -20 °C

Storage Comment: -20°C

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone

Target Type: Hormone

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process