beta Defensin 1 antibody (AA 1-36)

Catalog No. ABIN234969

This anti-beta Defensin 1 antibody is a Mouse Monoclonal antibody detecting beta Defensin 1 in WB and ELISA. Suitable for Human.

Quick Overview for beta Defensin 1 antibody (AA 1-36) (ABIN234969)

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This beta Defensin 1 antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Clone: M11-14b-D10

Product Details anti-beta Defensin 1 Antibody

Binding Specificity: AA 1-36

Specificity: Synthetic human beta-Defensin 1 (AA 1-36).

Characteristics: MAb to beta-Defensin-1 (AA 1-36), Monoclonal antibody to Human Defensin beta-1 (AA 1-36), Cell culture

Purification: Protein G Chromatography. Cell culture

Immunogen: Synthetic human beta-Defensin 1 (AA 1-36). (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)

Isotype: IgG1

Application Details

Application Notes: Suitable for use in ELISA and Western blot. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Reconstitute in 10 µL double distilled water.

Buffer: Lyophilized from 50 mM Tris, pH 7.4.

Preservative: Without preservative

Handling Advice: Avoid multiple freeze/thaw cycles.
Centrifuge product if not completely clear after standing at room temperature.
Prepare working dilution only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized product at 2-8 °C. After reconstitution, store at -28 °C.

Target Details for beta Defensin 1

Target: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Alternative Name: Defensin beta-1