TLR5 antibody (AA 151-181)

Catalog No. ABIN2376359

The Goat Polyclonal anti-TLR5 antibody has been validated for IHC and ELISA. It is suitable to detect TLR5 in samples from Human.

Quick Overview for TLR5 antibody (AA 151-181) (ABIN2376359)

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This TLR5 antibody is un-conjugated

Application: Immunohistochemistry (IHC), ELISA

Product Details anti-TLR5 Antibody

Binding Specificity: AA 151-181

Sequence: DLSKNQIRSL YLHPSFGKLN SLKSIDFSSN Q

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)

Purification: Purified by immunoaffinity chromatography.

Immunogen: Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5.

Isotype: IgG

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 1 mg/mL BSA, 0.09 % sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: 4°C (-20°C Glycerol)

Target Details for TLR5

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Alternative Name: TLR5

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades