BMI1 antibody (AA 135-165)

Catalog No. ABIN2617613

This Rabbit Polyclonal antibody specifically detects BMI1 in WB. It exhibits reactivity toward Human, Mouse, Rat, Horse, Pig, Monkey and Chimpanzee.

Quick Overview for BMI1 antibody (AA 135-165) (ABIN2617613)

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Reactivity: Human, Mouse, Rat, Horse, Pig, Monkey, Chimpanzee

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BMI1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BMI1 Antibody

Binding Specificity: AA 135-165

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide per 100 μg antibody.

Preservative: Sodium azide, Thimerosal (Merthiolate)

Precaution of Use: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Handling Advice: Avoid freeze-thaw cycles.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for BMI1

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Alternative Name: BMI1 / PCGF4

Background: Name/Gene ID: BMI1

Synonyms: BMI1, BMI-1, Flvi-2/bmi-1, FLVI2/BMI1, PCGF4, Polycomb group protein Bmi1, Polycomb complex protein BMI-1, Dna-binding protein bmi-1, Polycomb group ring finger 4, RING finger protein 51, RNF51

Gene ID: 648

Pathways: Cell Division Cycle, Autophagy