EPAS1 antibody (AA 202-240)

Catalog No. ABIN2621893

This anti-EPAS1 antibody is a Rabbit Polyclonal antibody detecting EPAS1 in WB, IHC and IHC (p). Suitable for Rat and Orang-Utan.

Quick Overview for EPAS1 antibody (AA 202-240) (ABIN2621893)

Target: EPAS1 (Endothelial PAS Domain Protein 1 (EPAS1))

Reactivity: Rat, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPAS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-EPAS1 Antibody

Binding Specificity: AA 202-240

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha(202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD).

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Rat

Restrictions: For Research Use only

Handling

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide per 100 μg antibody.

Preservative: Sodium azide, Thimerosal (Merthiolate)

Precaution of Use: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Handling Advice: Avoid freeze-thaw cycles.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for EPAS1

Target: EPAS1 (Endothelial PAS Domain Protein 1 (EPAS1))

Alternative Name: HIF2A / EPAS1

Background: Name/Gene ID: EPAS1

Synonyms: EPAS1, BHLHe73, ECYT4, HIF-1-alpha-like factor, HIF2-alpha, HIF2A, EPAS-1, HIF-2-alpha, HIF-1alpha-like factor, MOP2, Member of PAS protein 2, PASD2

Gene ID: 2034

Pathways: Signaling Events mediated by VEGFR1 and VEGFR2, Warburg Effect