VEGFA antibody

Catalog No. ABIN2629817

This anti-VEGFA antibody is a Goat Polyclonal antibody detecting VEGFA in WB and IF. Suitable for Human, Rat, Mouse, Pig, Dog, Rabbit, Cow, Chicken, Horse, Sheep, Guinea Pig, Monkey, Cat, Donkey, Goat and Hamster.

Quick Overview for VEGFA antibody (ABIN2629817)

Target: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Reactivity: Human, Rat, Mouse, Pig, Dog, Rabbit, Cow, Chicken, Horse, Sheep, Guinea Pig, Monkey, Cat, Donkey, Goat, Hamster

Host: Goat

Clonality: Polyclonal

Conjugate: This VEGFA antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF)

Product Details anti-VEGFA Antibody

Specificity: Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.

Purification: Immunoaffinity purified

Immunogen: Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)

Isotype: IgG

Application Details

Application Notes: Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 20 % glycerol, 0.05 % sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C,-20 °C

Storage Comment: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Target Details for VEGFA

Target: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Alternative Name: VEGFA / VEGF

Background: Name/Gene ID: VEGFA
Family: PDGF

Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1

Gene ID: 7422

UniProt: P15692

Pathways: RTK Signaling, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling