Phospholamban antibody (AA 1-35)

Catalog No. ABIN2743682

The Rabbit Polyclonal anti-Phospholamban antibody has been validated for WB. It is suitable to detect Phospholamban in samples from Human, Rat and Mouse.

Quick Overview for Phospholamban antibody (AA 1-35) (ABIN2743682)

Target: Phospholamban (PLN)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Phospholamban antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Phospholamban Antibody

Binding Specificity: AA 1-35

Specificity: Heart muscle (at protein level). .

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PLN(1-35aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for Phospholamban

Target: Phospholamban (PLN)

Alternative Name: PLN / Phospholamban

Background: Name/Gene ID: PLN

Synonyms: PLN, CMD1P, CMH18, PLB, Cardiac phospholamban, Phospholamban

Gene ID: 5350

Pathways: Negative Regulation of Transporter Activity