SMN1 antibody (AA 22-52)

Catalog No. ABIN2744443

This Rabbit Polyclonal antibody specifically detects SMN1 in WB, IHC and IHC (p). It exhibits reactivity toward Human, Mouse, Rat, Monkey, Dog, Rabbit and Chimpanzee.

Quick Overview for SMN1 antibody (AA 22-52) (ABIN2744443)

Target: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Reactivity: Human, Mouse, Rat, Monkey, Dog, Rabbit, Chimpanzee

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMN1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-SMN1 Antibody

Binding Specificity: AA 22-52

Specificity: Expressed in a wide variety of tissues. Expressed at high levels in brain, kidney and liver, moderate levels in skeletal and cardiac muscle, and low levels in fibroblasts and lymphocytes. Also seen at high levels in spinal cord. Present in osteoclasts and mononuclear cells (at protein level). .

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2(22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for SMN1

Target: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Alternative Name: SMN1

Background: Name/Gene ID: SMN1

Synonyms: SMN1, BCD541, Component of gems 1, Gemin-1, SMA2, SMA4, SMA@, SMA1, SMNC, SMNT, T-BCD541, SMN, Survival motor neuron protein, Gemin 1, GEMIN1, SMA, SMA3

Gene ID: 6606

Pathways: Ribonucleoprotein Complex Subunit Organization