Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

SCGB2A1 antibody (Secretoglobin, Family 2A, Member 1) (AA 1-95) Primary Antibody

SCGB2A1 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 1G10 unconjugated
Catalog No. ABIN2752438
$524.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target See all SCGB2A1 Antibodies
    SCGB2A1
    Binding Specificity
    • 15
    • 7
    • 4
    • 3
    • 1
    • 1
    • 1
    AA 1-95
    Reactivity
    • 44
    • 8
    Human
    Host
    • 38
    • 7
    Mouse
    Clonality
    • 45
    Monoclonal
    Conjugate
    • 13
    • 5
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This SCGB2A1 antibody is un-conjugated
    Application
    • 21
    • 13
    • 13
    • 13
    • 9
    • 6
    • 5
    • 3
    • 2
    • 2
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a full-length recombinant SCGB2A1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: SCGB2A1 (NP_002398.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN

    Clone
    1G10
    Isotype
    IgG1 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    SCGB2A1
    Alternative Name
    SCGB2A1 (SCGB2A1 Products)
    Synonyms
    LPHC, LPNC, MGB2, UGB3, Psbp1, secretoglobin family 2A member 1, secretoglobin, family 2A, member 1, SCGB2A1, Scgb2a1
    Background
    Full Gene Name: secretoglobin, family 2A, member 1
    Synonyms: LPHC,MGB2,MGC71973,UGB3
    Gene ID
    4246
    NCBI Accession
    NP_002398, NM_002407
You are here:
help Support