HKDC1 antibody (N-Term)

Catalog No. ABIN3042446

Product Details anti-HKDC1 Antibody

Target: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Binding Specificity: AA 102-136, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HKDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Putative hexokinase HKDC1(HKDC1) detection. Tested with WB in Human.

Sequence: KRHVQMESQF YPTPNEIIRG NGTELFEYVA DCLAD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Putative hexokinase HKDC1(HKDC1) detection. Tested with WB in Human.
Gene Name: hexokinase domain containing 1
Protein Name: Putative hexokinase HKDC1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1(102-136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for HKDC1 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HKDC1

Target: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Alternative Name: HKDC1 (HKDC1 Products)

Synonyms: cb370 antibody, sb:cb370 antibody, HKDC1 antibody, BC016235 antibody, hexokinase domain containing 1 antibody, putative hexokinase HKDC1 antibody, hkdc1 antibody, HKDC1 antibody, LOC100088018 antibody, Hkdc1 antibody

Background: The epidermal growth factor receptor (HKDC1, ErbB-1, HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: HKDC1 (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). HKDC1 exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). HKDC1 and its ligands are cell signaling molecules involved in diverse cellular functions, including cell proliferation, differentiation, motility, and survival, and in tissue development. Mutations that lead to HKDC1 overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer and glioblastoma multiforme. In this latter case a more or less specific mutation of HKDC1, called HKDC1vIII is often observed.

Synonyms: BC016235 antibody|Hexokinase domain-containing protein 1 antibody|Hkdc1 antibody| HKDC1_HUMAN antibody|Putative hexokinase HKDC1 antibody

Gene ID: 80201