Cytokeratin 19 antibody (C-Term)

Catalog No. ABIN3043288

Product Details anti-Cytokeratin 19 Antibody

Target: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Binding Specificity: AA 334-372, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytokeratin 19 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Keratin, type I cytoskeletal 19(KRT19) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: QLAHIQALIS GIEAQLGDVR ADSERQNQEY QRLMDIKSR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Keratin, type I cytoskeletal 19(KRT19) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: keratin 19
Protein Name: Keratin, type I cytoskeletal 19

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-Cytokeratin 19 antibody (ABIN3043288)

Quan, Du, Hou, Wang, Zhang: "Utilization of E-cadherin by monocytes from tumour cells plays key roles in the progression of bone invasion by oral squamous cell carcinoma." in: Oncology reports, Vol. 38, Issue 2, pp. 850-858, (2017) (PubMed).

Jeng, Jeng, Jeng, Sheen, Li, Lu, Chang: "Tropism of liver epithelial cells toward hepatocellular carcinoma in vitro and in vivo with altering gene expression of cancer stem cells." in: American journal of surgery, Vol. 215, Issue 4, pp. 735-743, (2017) (PubMed).

Li, Zhang, Zhang, Liu, Qi, Zhao, Jiang, Zhai, Ji, Luo: "Stem cell-like circulating tumor cells indicate poor prognosis in gastric cancer." in: BioMed research international, Vol. 2014, pp. 981261, (2015) (PubMed).

Yin, Tian, Ye, Li, Wang, Cheng, Chen, Guo, Huang: "Nanog and ?-catenin: a new convergence point in EpSC proliferation and differentiation." in: International journal of molecular medicine, Vol. 29, Issue 4, pp. 587-92, (2012) (PubMed).

Lu, Gu, Xu, Liu, Xie, Song: "Adult islets cultured in collagen gel transdifferentiate into duct-like cells." in: World journal of gastroenterology, Vol. 11, Issue 22, pp. 3426-30, (2005) (PubMed).

Target Details for Cytokeratin 19

Target: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Alternative Name: KRT19 (KRT19 Products)

Synonyms: CK19 antibody, K19 antibody, K1CS antibody, AI663979 antibody, EndoC antibody, Krt-1.19 antibody, Krt1-19 antibody, Ka19 antibody, k19 antibody, ck19 antibody, k1cs antibody, krt9 antibody, krt15 antibody, MGC76282 antibody, GK-19 antibody, MGC83069 antibody, KRT19 antibody, keratin 19 antibody, keratin 19 L homeolog antibody, keratin, type I cytoskeletal 19 antibody, KRT19 antibody, Krt19 antibody, krt19 antibody, krt19.L antibody, LOC100344434 antibody, LOC101117946 antibody

Background: Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.

Synonyms: 40 kDa keratin intermediate filament antibody|CK 19 antibody|CK-19 antibody|ck19 antibody| Cytokeratin 19 antibody|Cytokeratin-19 antibody|k19 antibody|K1C19_HUMAN antibody|k1cs antibody|Keratin 19 antibody|Keratin type I 40 kD antibody|Keratin type i 40kD antibody| Keratin type I cytoskeletal 19 antibody|Keratin, type I cytoskeletal 19 antibody|Keratin, type I, 40 kd antibody|Keratin-19 antibody|krt19 antibody|mgc15366 antibody

Gene ID: 3880

UniProt: P08727