c-Rel antibody (Middle Region)

Catalog No. ABIN3043314

Product Details anti-c-Rel Antibody

Target: c-Rel (REL proto-oncogene (c-Rel))

Binding Specificity: AA 268-306, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This c-Rel antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel(REL) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: DQEVSESMDF RYLPDEKDAY GNKSKKQKTT LIFQKLLQD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel(REL) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: v-rel avian reticuloendotheliosis viral oncogene homolog
Protein Name: Proto-oncogene c-Rel

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for c-Rel

Target: c-Rel (REL proto-oncogene (c-Rel))

Alternative Name: REL (c-Rel Products)

Synonyms: C-Rel antibody, c-Rel antibody, NFkB antibody, c-rel antibody, zgc:100833 antibody, Xrel2 antibody, Xrel3 antibody, rel antibody, rel-A antibody, rel2 antibody, rel3 antibody, v-rel antibody, xrel antibody, REL proto-oncogene, NF-kB subunit antibody, reticuloendotheliosis oncogene antibody, RELA proto-oncogene, NF-kB subunit antibody, v-rel avian reticuloendotheliosis viral oncogene homolog antibody, v-rel avian reticuloendotheliosis viral oncogene homolog L homeolog antibody, ribonuclease A family member 2 pseudogene antibody, REL antibody, Rel antibody, Rela antibody, rel antibody, rel.L antibody, ECRP antibody

Background: The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-κB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.

Synonyms: Avian reticuloendotheliosis antibody|C REL antibody|C Rel protein antibody|c Rel proto oncogene protein antibody|Oncogene REL antibody|Oncogene REL avian reticuloendotheliosis antibody|Proto-oncogene c-Rel antibody|REL antibody|REL_HUMAN antibody|v rel avian reticuloendotheliosis viral oncogene homolog antibody|v rel reticuloendotheliosis viral oncogene homolog antibody|V rel reticuloendotheliosis viral oncogene homolog (avian) antibody

Gene ID: 19696

UniProt: P15307