CD19 antibody (Middle Region)
-
- Target See all CD19 Antibodies
- CD19 (CD19 Molecule (CD19))
-
Binding Specificity
- AA 307-337, Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CD19 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for B-lymphocyte antigen CD19(CD19) detection. Tested with WB, IHC-P in Human.
- Sequence
- LVGILHLQRA LVLRRKRKRM TDPTRRFFKV T
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for B-lymphocyte antigen CD19(CD19) detection. Tested with WB, IHC-P in Human.
Gene Name: CD19 Molecule
Protein Name: B-lymphocyte antigen CD19 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT), different from the related mouse sequence by seven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CD19 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CD19 (CD19 Molecule (CD19))
- Alternative Name
- CD19 (CD19 Products)
- Synonyms
- B4 antibody, CVID3 antibody, AW495831 antibody, CD19 antibody, CD19 molecule antibody, CD19 antigen antibody, CD19 antibody, Cd19 antibody
- Background
-
B-lymphocyte antigen CD19, also known as CD19 (Cluster of Differentiation 19), is a protein that in humans is encoded by the CD19 gene. It is found on the surface of B-cells, a type of white blood cell. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. The CD19 gene encodes a cell surface molecule that assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
Synonyms: Antibody deficiency due to defect in CD19, included antibody|AW495831 antibody|B lymphocyte antigen CD19 antibody|B lymphocyte surface antigen B4 antibody|B-lymphocyte antigen CD19 antibody|B-lymphocyte surface antigen B4 antibody|B4 antibody|CD19 antibody|CD19 antigen antibody|CD19 Molecule antibody|Cd19 protein antibody|CD19_HUMAN antibody|CVID3 antibody|Differentiation antigen CD19 antibody|Leu 12 antibody|Leu-12 antibody|Leu12 antibody|MGC109570 antibody|MGC12802 antibody|T-cell surface antigen Leu-12 antibody - Gene ID
- 930
- UniProt
- P15391
- Pathways
- Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway
-