TAP2 antibody (C-Term)
-
- Target See all TAP2 Antibodies
- TAP2 (Transporter 2, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP2))
-
Binding Specificity
- AA 611-651, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TAP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Antigen peptide transporter 2(TAP2) detection. Tested with WB in Human.
- Sequence
- QKQRLAIARA LVRDPRVLIL DEATSALDVQ CEQALQDWNS R
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Antigen peptide transporter 2(TAP2) detection. Tested with WB in Human.
Gene Name: transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
Protein Name: Antigen peptide transporter 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611-651aa QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product TAP2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TAP2 (Transporter 2, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP2))
- Alternative Name
- TAP2 (TAP2 Products)
- Synonyms
- ABC18 antibody, ABCB3 antibody, APT2 antibody, D6S217E antibody, PSF-2 antibody, PSF2 antibody, RING11 antibody, AI462429 antibody, Abcb3 antibody, Ham-2 antibody, Ham2 antibody, MTP2 antibody, Tap-2 antibody, Y1 antibody, jas antibody, Cim antibody, transporter 2, ATP binding cassette subfamily B member antibody, transporter 2, ATP-binding cassette, sub-family B (MDR/TAP) antibody, TAP2 antibody, Tap2 antibody
- Background
-
Transporter, ATP-binding cassette, major histocompatibility complex 2(TAP2) is a gene in humans that encodes the protein Antigen peptide transporter 2. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. The gene is assigned to human chromosome 6p21.3. It is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. And this protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum.
Synonyms: ABC transporter, MHC 2 antibody|ABC18 antibody|ABCB3 antibody|Antigen peptide transporter 2 antibody|APT2 antibody|ATP binding cassette, sub family B (MDR/TAP), member 3 antibody|D6S217E antibody|Peptide supply factor 2 antibody|Peptide transporter involved in antigen processing 2 antibody|Peptide transporter PSF2 antibody|Peptide transporter TAP2 antibody|PSF 2 antibody|PSF2 antibody|Really interesting new gene 11 protein antibody|RING 11 antibody|RING11 antibody|TAP 2 antibody|Transporter 2 ATP binding cassette sub family B antibody|Transporter 2, ABC (ATP binding cassette antibody|Transporter 2, ATP binding cassette, sub family B (MDR/TAP) antibody - Gene ID
- 6891
- UniProt
- Q03519
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-