Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

BMP2 antibody (C-Term)

BMP2 Reactivity: Human, Rat WB, ELISA, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043489
  • Target See all BMP2 Antibodies
    BMP2 (Bone Morphogenetic Protein 2 (BMP2))
    Binding Specificity
    • 15
    • 15
    • 15
    • 6
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 283-312, C-Term
    Reactivity
    • 94
    • 49
    • 49
    • 22
    • 16
    • 14
    • 12
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Human, Rat
    Host
    • 110
    • 19
    • 6
    • 1
    Rabbit
    Clonality
    • 119
    • 17
    Polyclonal
    Conjugate
    • 64
    • 26
    • 12
    • 6
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This BMP2 antibody is un-conjugated
    Application
    • 127
    • 52
    • 45
    • 26
    • 26
    • 19
    • 18
    • 14
    • 13
    • 11
    • 9
    • 7
    • 6
    • 4
    • 3
    • 2
    • 2
    • 1
    Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Bone morphogenetic protein 2(BMP2) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
    Sequence
    QAKHKQRKRL KSSCKRHPLY VDFSDVGWND
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Bone morphogenetic protein 2(BMP2) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
    Gene Name: bone morphogenetic protein 2
    Protein Name: Bone morphogenetic protein 2
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product BMP2 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Jian, Fan, Hu, He, Li, Zheng, Ren, Li: "Effects of rhBMP-2 gene transfection to periodontal ligament cells on osteogenesis." in: Bioscience reports, Vol. 37, Issue 3, (2018) (PubMed).

    Fernández, Córdoba: "Hyaluronic acid-induced capacitation involves protein kinase C and tyrosine kinase activity modulation with a lower oxidative metabolism in cryopreserved bull sperm." in: Theriogenology, Vol. 122, pp. 68-73, (2018) (PubMed).

    Xu, Sun, Zhang, Xu, Du, Zhang, Wang: "Diabetes mellitus affects the biomechanical function of the callus and the expression of TGF-beta1 and BMP2 in an early stage of fracture healing." in: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 49, Issue 1, pp. e4736, (2016) (PubMed).

    Liu, Chen, Zeng, Cui, Ning, Wang, Belguise, Wang, Qian, Lu, Yi: "Bone morphogenic protein-2 regulates the myogenic differentiation of PMVECs in CBDL rat serum-induced pulmonary microvascular remodeling." in: Experimental cell research, Vol. 336, Issue 1, pp. 109-18, (2015) (PubMed).

    Wang, Xue, Zhao, Liu, Ma, Ma: "Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).

    Chai, Guo, Wang, Gao, Liu, Fu, Guan, Tan, Yang: "In vitro and in vivo evaluations on osteogenesis and biodegradability of a β-tricalcium phosphate coated magnesium alloy." in: Journal of biomedical materials research. Part A, Vol. 100, Issue 2, pp. 293-304, (2014) (PubMed).

    Guo, Zeng, Yan, Shen, Liu, Li, Zhang, Wu, Guan, Huang: "Proliferative effect and osteoinductive potential of extracellular matrix coated on cell culture plates." in: SpringerPlus, Vol. 2, Issue 1, pp. 303, (2014) (PubMed).

    Sun, Sun, Tian, Xu, Zhou, Xi, Yan, Wang: "A comparison of osteocyte bioactivity in fine particulate bone powder grafts vs larger bone grafts in a rat bone repair model." in: Acta histochemica, Vol. 116, Issue 6, pp. 1015-21, (2014) (PubMed).

    Zhong, Liu, Dai, Zhou, Fu: "Sodium thiosulfate protects human aortic smooth muscle cells from osteoblastic transdifferentiation via high-level phosphate." in: The Kaohsiung journal of medical sciences, Vol. 29, Issue 11, pp. 587-93, (2013) (PubMed).

    Qiao, Zhang, Jin, Miao, Shi, Liu, Yuan, Liu, Li, Zheng, Zhang, Li, Yang, Sun: "Using poly(lactic-co-glycolic acid) microspheres to encapsulate plasmid of bone morphogenetic protein 2/polyethylenimine nanoparticles to promote bone formation in vitro and in vivo." in: International journal of nanomedicine, Vol. 8, pp. 2985-95, (2013) (PubMed).

    Li, Chen, Wu, Jiang, Ge, Gao, Zhang, Wu: "Enhancement of the osseointegration of a polyethylene terephthalate artificial ligament graft in a bone tunnel using 58S bioglass." in: International orthopaedics, Vol. 36, Issue 1, pp. 191-7, (2012) (PubMed).

    Wang, Liu, Dang, Ma, Zhang, Wang: "The effect of core decompression on local expression of BMP-2, PPAR-γ and bone regeneration in the steroid-induced femoral head osteonecrosis." in: BMC musculoskeletal disorders, Vol. 13, pp. 142, (2012) (PubMed).

    Chen, Kong, Wan, Xiao, Li, Wang, Lin, Wang: "Effects of huogu I formula (I) on correlated factors of bone regeneration in chickens with steroid-induced necrosis of femoral head." in: Chinese journal of integrative medicine, Vol. 18, Issue 5, pp. 378-84, (2012) (PubMed).

    Liao, Chen, Li, Ge, Duan, Zou, Ge: "Transfer of bone-marrow-derived mesenchymal stem cells influences vascular remodeling and calcification after balloon injury in hyperlipidemic rats." in: Journal of biomedicine & biotechnology, Vol. 2012, pp. 165296, (2012) (PubMed).

    Yao, Wang, Wang, Wang, Zhang, Liu: "Synergistic enhancement of new bone formation by recombinant human bone morphogenetic protein-2 and osteoprotegerin in trans-sutural distraction osteogenesis: a pilot study in dogs." in: Journal of oral and maxillofacial surgery : official journal of the American Association of Oral and Maxillofacial Surgeons, Vol. 69, Issue 11, pp. e446-55, (2011) (PubMed).

    Han, Li, Guan: "Ectopic osteogenesis of hBMP-2 gene-transduced human bone mesenchymal stem cells/BCB." in: Connective tissue research, Vol. 51, Issue 4, pp. 274-81, (2010) (PubMed).

    Liu, Zhong, Liang, Fu, Luo, Zhou, Gou, Huang: "Effect of high glucose levels on the calcification of vascular smooth muscle cells by inducing osteoblastic differentiation and intracellular calcium deposition via BMP-2/Cbfα-1 pathway." in: Journal of Zhejiang University. Science. B, Vol. 11, Issue 12, pp. 905-11, (2010) (PubMed).

    Ma, Ma, Guo, Zhang: "Expression of bone morphogenetic protein-2 and its receptors in epithelial ovarian cancer and their influence on the prognosis of ovarian cancer patients." in: Journal of experimental & clinical cancer research : CR, Vol. 29, pp. 85, (2010) (PubMed).

    Tian, Sun, Zhang, Gao, Fu, Yang: "Construction and expression of a bicistronic vector containing human bone morphogenetic protein 2 and vascular endothelial growth factor-165 genes in vitro." in: Chinese medical journal, Vol. 122, Issue 4, pp. 471-3, (2009) (PubMed).

    Hu, Cui, Yang, Wang, Hu, Li, Zeng: "Bone morphogenetic protein-2: a potential regulator in scleral remodeling." in: Molecular vision, Vol. 14, pp. 2373-80, (2008) (PubMed).

  • Target
    BMP2 (Bone Morphogenetic Protein 2 (BMP2))
    Alternative Name
    BMP2 (BMP2 Products)
    Synonyms
    BDA2 antibody, BMP2A antibody, AI467020 antibody, Bmp2a antibody, BMP-2 antibody, xBMP-2 antibody, xbmp2 antibody, BMP2 antibody, bmp2a antibody, bmp2 antibody, wu:fc59d09 antibody, bone morphogenetic protein 2 antibody, bone morphogenetic protein 2 L homeolog antibody, Bone morphogenetic protein 2 antibody, bone morphogenetic protein 2a antibody, BMP2 antibody, Bmp2 antibody, bmp2.L antibody, bmp2 antibody, bmp2a antibody
    Background
    BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. BMP-2, like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in the hedgehog pathway, TGF beta signaling pathway, and in cytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation and epithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.

    Synonyms: BDA2 antibody|BMP-2 antibody|BMP-2A antibody|Bmp2 antibody|BMP2_HUMAN antibody|BMP2A antibody|Bone morphogenetic protein 2 antibody| Bone morphogenetic protein 2A antibody
    Gene ID
    650
    UniProt
    P12643
    Pathways
    Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Regulation of Muscle Cell Differentiation, Growth Factor Binding, Positive Regulation of fat Cell Differentiation
You are here:
Support