alpha 1 Adrenergic Receptor antibody (C-Term)
-
- Target See all alpha 1 Adrenergic Receptor (ADRA1A) Antibodies
- alpha 1 Adrenergic Receptor (ADRA1A) (Adrenoceptor alpha 1A (ADRA1A))
-
Binding Specificity
- AA 335-373, C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This alpha 1 Adrenergic Receptor antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Alpha-1A adrenergic receptor(ADRA1A) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- KAFQNVLRIQ CLCRKQSSKH ALGYTLHPPS QAVEGQHKD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Alpha-1A adrenergic receptor(ADRA1A) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: adrenoceptor alpha 1A
Protein Name: Alpha-1A adrenergic receptor - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ADRA1A (335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ADRA1A Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- alpha 1 Adrenergic Receptor (ADRA1A) (Adrenoceptor alpha 1A (ADRA1A))
- Alternative Name
- ADRA1A (ADRA1A Products)
- Synonyms
- ADRA1C antibody, ADRA1L1 antibody, ALPHA1AAR antibody, Adra1c antibody, ALPHA-1A antibody, alpha-1A antibody, adrenoceptor alpha 1A antibody, adrenergic receptor, alpha 1a antibody, ADRA1A antibody, Adra1a antibody
- Background
-
ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.
Synonyms: ADA1D_HUMAN antibody|Adra1 antibody|Adra1a antibody|Adra1d antibody|ADRA1R antibody|Adrd1 antibody|Adrenergic alpha1A receptor antibody|Adrenergic alpha1D receptor antibody|Adrenergic receptor alpha 1d antibody|Adrenergic receptor delta1 antibody|Adrenoceptor alpha 1D antibody|Alpha 1D adrenoceptor antibody|Alpha 1D adrenoreceptor antibody|Alpha adrenergic receptor 1a antibody|Alpha-1A adrenergic receptor antibody|Alpha-1D adrenergic receptor antibody|Alpha-1D adrenoceptor antibody|Alpha-1D adrenoreceptor antibody| Alpha-adrenergic receptor 1a antibody|ALPHA1 antibody|Alpha1A adrenergic receptor antibody|Alpha1D adrenergic receptor antibody| Alpha1DAR antibody|DAR antibody|dJ779E11.2 antibody|Gpcr8 antibody|RA42 antibody|Spr8 antibody - Gene ID
- 148
- UniProt
- P35348
- Pathways
- AMPK Signaling
-