Aspartate beta Hydroxylase antibody (C-Term)
-
- Target See all Aspartate beta Hydroxylase (ASPH) Antibodies
- Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))
-
Binding Specificity
- AA 726-758, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Aspartate beta Hydroxylase antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Aspartyl/asparaginyl beta-hydroxylase(ASPH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- EVWQDASSFR LIFIVDVWHP ELTPQQRRSL PAI
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Aspartyl/asparaginyl beta-hydroxylase(ASPH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aspartate beta-hydroxylase
Protein Name: Aspartyl/asparaginyl beta-hydroxylase - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product ASPH Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))
- Alternative Name
- ASPH (ASPH Products)
- Background
-
ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.
Synonyms: A beta H J J antibody|AAH antibody|ASP beta hydroxylase antibody|Aspartyl/asparaginyl beta hydroxylase antibody|ASPH antibody|ASPH_HUMAN antibody|BAH antibody|Cardiac junctin antibody|CASQ2BP1 antibody|HAAH antibody|Humbug antibody|JCTN antibody|junctin antibody| Peptide aspartate beta dioxygenase antibody - Gene ID
- 444
- UniProt
- Q12797
- Pathways
- Positive Regulation of Endopeptidase Activity
-