BMI1 antibody (Middle Region)

Catalog No. ABIN3043799

Product Details anti-BMI1 Antibody

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Binding Specificity: AA 135-165, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BMI1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Polycomb complex protein BMI-1(BMI1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: IEFFDQNRLD RKVNKDKEKS KEEVNDKRYL R

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Polycomb complex protein BMI-1(BMI1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: BMI1 proto-oncogene, polycomb ring finger
Protein Name: Polycomb complex protein BMI-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat, The detection limit for Bmi1 is approximately 0.25 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for BMI1

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Alternative Name: BMI1 (BMI1 Products)

Synonyms: FLVI2/BMI1 antibody, PCGF4 antibody, RNF51 antibody, AW546694 antibody, Bmi-1 antibody, Pcgf4 antibody, bmi1 antibody, pcgf4 antibody, psc1 antibody, wu:fb17g03 antibody, wu:fd18f06 antibody, BMI-1 antibody, pcgf4b antibody, bmi-1 antibody, bmi1-a antibody, bmi1-b antibody, bmi1b antibody, rnf51 antibody, xbmi-1 antibody, BMI1 proto-oncogene, polycomb ring finger antibody, BMI1 polycomb ring finger oncogene antibody, Bmi1 polycomb ring finger oncogene antibody, bmi1 polycomb ring finger oncogene 1a antibody, bmi1 polycomb ring finger oncogene 1b antibody, BMI1 proto-oncogene, polycomb ring finger L homeolog antibody, BMI1 antibody, LOC100230513 antibody, Bmi1 antibody, bmi1a antibody, bmi1b antibody, bmi1.L antibody

Background: BMI1(BMI1 polycomb ring finger oncogene), also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The Bmi1 gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human BMI1 gene is assigned to chromosome 10p13. BMI1 has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that BMI1 completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that BMI1 transiently colocalized with centromeres during interphase in HeLa cells.

Synonyms: B lymphoma Mo MLV insertion region (mouse) antibody|B lymphoma Mo MLV insertion region 1 homolog antibody|Bmi 1 antibody|BMI1 antibody|BMI1 polycomb ring finger oncogene antibody|BMI1_HUMAN antibody|Flvi 2/bmi 1 antibody|FLVI2/BMI1 antibody|MGC12685 antibody|Murine leukemia viral (bmi 1) oncogene homolog antibody|Oncogene BMI 1 antibody|PCGF 4 antibody|PCGF4 antibody|Polycomb complex protein BMI 1 antibody|Polycomb complex protein BMI-1 antibody|Polycomb group protein Bmi1 antibody|Polycomb group ring finger 4 antibody|Polycomb group RING finger protein 4 antibody|RING finger protein 51 antibody|RNF 51 antibody|RNF51 antibody

Gene ID: 648

UniProt: P35226

Pathways: Cell Division Cycle, Autophagy