GREM1 antibody (C-Term)

Catalog No. ABIN3043836

Product Details anti-GREM1 Antibody

Target: GREM1 (Gremlin 1 (GREM1))

Binding Specificity: AA 151-184, C-Term

Reactivity: Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GREM1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Gremlin-1(GREM1) detection. Tested with WB in Human,Rat.

Sequence: TMMVTLNCPE LQPPTKKKRV TRVKQCRCIS IDLD

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for Gremlin-1(GREM1) detection. Tested with WB in Human,Rat.
Gene Name: gremlin 1
Protein Name: Gremlin-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for GREM1

Target: GREM1 (Gremlin 1 (GREM1))

Alternative Name: GREM1 (GREM1 Products)

Synonyms: grem1 antibody, MGC136702 antibody, zgc:136702 antibody, GREM1 antibody, drm antibody, pig2 antibody, dand2 antibody, ihg-2 antibody, gremlin antibody, Cktsf1b1 antibody, Drm antibody, Grem antibody, ld antibody, gremlin-1 antibody, CKTSF1B1 antibody, DAND2 antibody, DRM antibody, GREMLIN antibody, IHG-2 antibody, cktsf1b1 antibody, gremlin 1a, DAN family BMP antagonist antibody, gremlin 1, DAN family BMP antagonist antibody, gremlin 1 antibody, gremlin 1, DAN family BMP antagonist L homeolog antibody, grem1a antibody, GREM1 antibody, LOC662541 antibody, grem1 antibody, Grem1 antibody, grem1.L antibody

Background: Gremlin, also known as Drm, is a highly conserved 20.7- kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.

Synonyms: BMP antagonist 1 antibody|Cell proliferation inducing gene 2 protein antibody|Cell proliferation-inducing gene 2 protein antibody| CKTSF1B1 antibody|Cysteine knot superfamily 1 antibody|Cysteine knot superfamily 1, BMP antagonist 1 antibody|Cysteine knot superfamily BMP antagonist 1 antibody|DAN domain family member 2 antibody|DAND2 antibody|Down regulated in Mos-transformed cells protein antibody|Down-regulated in Mos-transformed cells protein antibody|DRM antibody|grem1 antibody|GREM1_HUMAN antibody|Gremlin 1 like protein antibody| Gremlin 1, cysteine knot superfamily, homolog antibody|GREMLIN antibody|Gremlin-1 antibody| Gremlin1 antibody| IHG-2 antibody|IHG2 antibody|Increased in high glucose 2 antibody| Increased in high glucose protein 2 antibody|PIG2 antibody| Proliferation inducing gene 2 antibody|proliferation inducing gene 2 protein antibody

Gene ID: 26585

UniProt: O60565

Pathways: Regulation of Muscle Cell Differentiation, Tube Formation, Maintenance of Protein Location