SOD2 antibody (C-Term)

Catalog No. ABIN3043935

Product Details anti-SOD2 Antibody

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Binding Specificity: AA 192-222, C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SOD2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Superoxide dismutase [Mn], mitochondrial(SOD2) detection. Tested with WB, IHC-P in Human,Mouse.

Sequence: QYKNVRPDYL KAIWNVINWE NVTERYMACK K

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Superoxide dismutase [Mn], mitochondrial(SOD2) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: superoxide dismutase 2, mitochondrial
Protein Name: Superoxide dismutase [Mn], mitochondrial

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, The detection limit for SOD2 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-SOD2 antibody (ABIN3043935)

Zhang, Deng, Lai, Guan, Sun, Han, Wang, Pan, Ji, Luo, Huang, Tang, Gu, Dan, Yu, Namaka, Zhang, Deng, Li: "Maternal inflammation activated ROS-p38 MAPK predisposes offspring to heart damages caused by isoproterenol via augmenting ROS generation." in: Scientific reports, Vol. 6, pp. 30146, (2018) (PubMed).

Target Details for SOD2

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Alternative Name: SOD2 (SOD2 Products)

Synonyms: LOC100101896 antibody, MNSOD antibody, GB14346 antibody, sod2 antibody, MGC88869 antibody, Sod2 antibody, CG8905 antibody, Dmel\\CG8905 antibody, Mito SOD antibody, Mn SOD antibody, Mn-SOD antibody, Mn-SOD2 antibody, MnSOD antibody, MnSODII antibody, Mn[2+]SOD antibody, SOD antibody, SOD-2 antibody, SOD2 antibody, Sod-2 antibody, dSOD2 antibody, mitSOD2 antibody, mnSOD antibody, IPOB antibody, MVCD6 antibody, cb463 antibody, wu:fj33b01 antibody, zgc:73051 antibody, MnSOD antibody, manganese superoxide dismutase antibody, superoxide dismutase 2, mitochondrial antibody, superoxide dismutase 2 antibody, Mn superoxide dismutase antibody, Superoxide dismutase 2 (Mn) antibody, superoxide dismutase 2 L homeolog antibody, BDBG_07234 antibody, LOC100101896 antibody, MNSOD antibody, Sod2 antibody, sod2 antibody, LbMnSOD4 antibody, SOD2 antibody, LOC100282741 antibody, SOD-2 antibody, sod2.L antibody

Background: SOD2(Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.

Synonyms: Indophenoloxidase B antibody|IPO B antibody|IPOB antibody|Manganese containing superoxide dismutase antibody|Manganese SOD antibody|Manganese superoxide dismutase antibody|Mangano superoxide dismutase antibody|Mn SOD antibody|Mn superoxide dismutase antibody|MNSOD antibody|MVCD6 antibody|SOD 2 antibody|SOD-2 antibody|SOD2 antibody|SODM_HUMAN antibody| Superoxide dismutase [Mn] mitochondrial antibody|Superoxide dismutase [Mn] mitochondrial precursor antibody|Superoxide dismutase [Mn], mitochondrial antibody|Superoxide dismutase 2 mitochondrial antibody

Gene ID: 6648

UniProt: P04179

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling