ACO2 antibody (C-Term)

Catalog No. ABIN4886417

Product Details anti-ACO2 Antibody

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Binding Specificity: AA 561-596, C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACO2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Aconitate hydratase, mitochondrial(ACO2) detection. Tested with WB in Human,Mouse,Rat.

Sequence: TSQRLQLLEP FDKWDGKDLE DLQILIKVKG KCTTDH

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Aconitate hydratase, mitochondrial(ACO2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: aconitase 2
Protein Name: Aconitate hydratase, mitochondrial

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aconitase 2 (561-596aa TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ACO2

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Alternative Name: ACO2 (ACO2 Products)

Synonyms: DDBDRAFT_0206187 antibody, DDBDRAFT_0230168 antibody, DDB_0206187 antibody, DDB_0230168 antibody, aconitase 2 antibody, F10M23.310 antibody, F10M23_310 antibody, ACONM antibody, ICRD antibody, Aco-2 antibody, Aco3 antibody, D10Wsu183e antibody, cb1017 antibody, wu:fa10e03 antibody, wu:fb69g04 antibody, wu:fc20c11 antibody, aconitase 2 antibody, aconitase 2 S homeolog antibody, aconitate hydratase, mitochondrial antibody, aconitase, mitochondrial antibody, mitochondrial aconitate hydratase antibody, aconitase 2, mitochondrial antibody, Probable aconitate hydratase, mitochondrial antibody, ACO2 antibody, aco2.S antibody, Bm1_07420 antibody, aco2 antibody, ach1 antibody, Aco2 antibody, aco-2 antibody

Background: Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Synonyms: ACO 2 | ACO2 | aconitase 2 | aconitase2 | aconitase-2 | Aconitate hydratase | ACONM | Citrate hydro lyase | ICRD | Q99798

Gene ID: 50

UniProt: Q99798