Calpastatin antibody (Middle Region)

Catalog No. ABIN4886503

Product Details anti-Calpastatin Antibody

Target: Calpastatin (CAST)

Binding Specificity: AA 275-310, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calpastatin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Calpastatin(CAST) detection. Tested with WB, IHC-P in Human.

Sequence: QEKKRKVEKD TMSDQALEAL SASLGTRQAE PELDLR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Calpastatin(CAST) detection. Tested with WB, IHC-P in Human.
Gene Name: calpastatin
Protein Name: Calpastatin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310aa QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by eleven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Calpastatin

Target: Calpastatin (CAST)

Alternative Name: CAST (CAST Products)

Synonyms: BS-17 antibody, calp3 antibody, CAST antibody, sb:cb966 antibody, zgc:194249 antibody, cast antibody, DKFZp469E0716 antibody, calpastatin antibody, calpastatin S homeolog antibody, Calpastatin antibody, CAST antibody, Cast antibody, cast.S antibody, cast antibody, VDBG_09182 antibody, ical antibody

Background: Calpastatin is a protein that in humans is encoded by the CAST gene. It is mapped to 5q15. The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described.

Synonyms: BS 17 | Calpain inhibitor | Calpastatin | Cast | PLACK | Sperm BS 17 component | Sperm BS-17 component | P20810

Gene ID: 831

UniProt: P20810