DHODH antibody (N-Term)

Catalog No. ABIN4886562

Product Details anti-DHODH Antibody

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Binding Specificity: AA 132-173, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHODH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT E

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: dihydroorotate dehydrogenase (quinone)
Protein Name: Dihydroorotate dehydrogenase (quinone), mitochondrial

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for DHODH

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Alternative Name: DHODH (DHODH Products)

Synonyms: DHOdehase antibody, POADS antibody, URA1 antibody, 2810417D19Rik antibody, AI834883 antibody, DDBDRAFT_0167009 antibody, DDBDRAFT_0185217 antibody, DDB_0167009 antibody, DDB_0185217 antibody, DHOD antibody, DHODase antibody, XFHB_12025 antibody, dhodh antibody, dihydroorotate dehydrogenase (quinone) antibody, dihydroorotate dehydrogenase antibody, dihydroorotate dehydrogenase (quinone) L homeolog antibody, DHODH antibody, Dhodh antibody, pyrD antibody, pyr4 antibody, Mrub_0263 antibody, Arnit_2124 antibody, Trad_2703 antibody, Ftrac_1484 antibody, Ndas_0799 antibody, Mesil_1876 antibody, Slip_0841 antibody, Spirs_1436 antibody, XFHB_RS12780 antibody, dhodh.L antibody

Background: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Synonyms: DHOdehase | Dhodh | POADS | URA1 | Q02127

Gene ID: 1723

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus