GPI antibody (N-Term)

Catalog No. ABIN4886609

Product Details anti-GPI Antibody

Target: GPI (Glucose-6-Phosphate Isomerase (GPI))

Binding Specificity: AA 2-39, N-Term

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPI antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Mouse.

Sequence: AALTRNPQFQ KLLEWHRANS ANLKLRELFE ADPERFNN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Mouse.
Gene Name: glucose-6-phosphate isomerase
Protein Name: Glucose-6-phosphate isomerase

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse GPI (2-39aa AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN), different from the related human sequence by sixteen amino acids, and from the related rat sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for GPI

Target: GPI (Glucose-6-Phosphate Isomerase (GPI))

Alternative Name: GPI (GPI Products)

Synonyms: PGI antibody, Amf antibody, Gpi1 antibody, GPI antibody, DDBDRAFT_0185620 antibody, DDBDRAFT_0231026 antibody, DDB_0185620 antibody, DDB_0231026 antibody, CG8251 antibody, Dmel\\CG8251 antibody, Gpi antibody, pgi antibody, Gpi-1 antibody, Gpi-1r antibody, Gpi-1s antibody, Gpi-1t antibody, Gpi1-r antibody, Gpi1-s antibody, Gpi1-t antibody, Gpi1s antibody, MF antibody, NK antibody, NK/GPI antibody, Org antibody, AMF antibody, GNPI antibody, NLK antibody, PHI antibody, SA-36 antibody, SA36 antibody, gpi antibody, pgi-2 antibody, glucose-6-phosphate isomerase antibody, gpi antibody, glucose-6-phosphate isomerase 1 antibody, gpi Glucose-6-phosphate isomerase antibody, Phosphoglucose isomerase antibody, glucose phosphate isomerase 1 antibody, glucose-6-phosphate isomerase b antibody, GPI antibody, Gpi antibody, gpi antibody, pgi antibody, GPI1 antibody, Pgi antibody, Gpi1 antibody, gpib antibody

Target Type: Viral Protein

Background: Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

Synonyms: AMF | Aurocrine motility factor | GNPI | GPI | Gpi1 | Neuroleukin | NLK | Oxoisomerase | PGI | PHI | SA36 | SA-36 | SA 36 | P06744

Gene ID: 14751

UniProt: P06745