IL7R antibody (C-Term)

Catalog No. ABIN4886632

Product Details anti-IL7R Antibody

Target: IL7R (Interleukin 7 Receptor (IL7R))

Binding Specificity: AA 278-315, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL7R antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Interleukin-7 receptor subunit alpha(IL7R) detection. Tested with WB in Human,Rat.

Sequence: DHKKTLEHLC KKPRKNLNVS FNPESFLDCQ IHRVDDIQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Interleukin-7 receptor subunit alpha(IL7R) detection. Tested with WB in Human,Rat.
Gene Name: interleukin 7 receptor
Protein Name: Interleukin-7 receptor subunit alpha

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for IL7R

Target: IL7R (Interleukin 7 Receptor (IL7R))

Alternative Name: IL7R (IL7R Products)

Synonyms: IL7R antibody, CD127 antibody, IL-7Ralpha antibody, CDW127 antibody, IL-7R-alpha antibody, IL7RA antibody, ILRA antibody, IL-7RA antibody, interleukin 7 receptor antibody, IL7R antibody, Il7r antibody

Background: The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).

Synonyms: CD 127 | CD127 | CD127 antigen | IL 7R alpha | IL-7R-alpha | IL 7R | IL7R | IL-7RA | IL7RA | IL7Ralpha | ILRA | Interleukin 7 receptor | P16871

Gene ID: 3575

UniProt: P16871

Pathways: JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response, Regulation of Cell Size