Peptide YY antibody (Middle Region)

Catalog No. ABIN4886709

Product Details anti-Peptide YY Antibody

Target: Peptide YY (PYY)

Binding Specificity: AA 29-64, Middle Region

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peptide YY antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Peptide YY(PYY) detection. Tested with WB in Mouse.

Sequence: YPAKPEAPGE DASPEELSRY YASLRHYLNL VTRQRY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Peptide YY(PYY) detection. Tested with WB in Mouse.
Gene Name: peptide YY
Protein Name: Peptide YY

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Peptide YY

Target: Peptide YY (PYY)

Alternative Name: PYY (PYY Products)

Background: Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.

Synonyms: GHYY | peptide YY | PYY 1 | PYY I | PYYI | PYY | PYY II | PYY-II | RATGHYY | Yy | Q9EPS2

Gene ID: 217212