BMP5 antibody

Catalog No. ABIN4950346

The Rabbit Polyclonal anti-BMP5 antibody has been validated for WB, ELISA, IHC (p) and FACS. It is suitable to detect BMP5 in samples from Human, Mouse and Rat.

Quick Overview for BMP5 antibody (ABIN4950346)

Target: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BMP5 antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Product Details anti-BMP5 Antibody

Purification: Antigen affinity

Immunogen: Amino acids HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL of human BMP5 were used as the immunogen for the BMP5 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the BMP5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,ELISA: 0.1-0.5 μg/mL (human protein tested)

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the BMP5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for BMP5

Target: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Alternative Name: BMP5

Background: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

UniProt: P22003

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process