SLUG antibody

Catalog No. ABIN4952602

The Rabbit Polyclonal anti-SLUG antibody has been validated for WB and IHC (p). It is suitable to detect SLUG in samples from Human, Mouse and Rat.

Quick Overview for SLUG antibody (ABIN4952602)

Target: SLUG (SNAI2) (Snail Family Zinc Finger 2 (SNAI2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLUG antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-SLUG Antibody

Purification: Antigen affinity

Immunogen: Amino acids KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ of human SLUG were used as the immunogen for the SLUG antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SLUG antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the SLUG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SLUG

Target: SLUG (SNAI2) (Snail Family Zinc Finger 2 (SNAI2))

Alternative Name: SLUG / SNAI2

Background: SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

UniProt: O43623